Protein Info for MPMX26_01675 in Acinetobacter radioresistens SK82

Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF02542: YgbB" amino acids 6 to 159 (154 residues), 223.6 bits, see alignment E=7.8e-71 TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase" amino acids 7 to 160 (154 residues), 219.6 bits, see alignment E=1.1e-69

Best Hits

Swiss-Prot: 87% identical to ISPF_ACIBS: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Acinetobacter baumannii (strain SDF)

KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 85% identity to acd:AOLE_07270)

MetaCyc: 58% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]

Predicted SEED Role

"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 4.6.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>MPMX26_01675 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Acinetobacter radioresistens SK82)
MLRPQFRIGQGIDVHAFEEGEFVHLAGVRIPHTHGLKAHSDGDVVLHALADALLGALALG
DIGQHFPDTDDEFKGADSRILLKHVYDLILKEGYMLGNADITVACERPKLAKHNLEMRQS
IAEVLNADISQISVKATTTEKLGFTGRQEGILATATVLLVLHSN