Protein Info for MPMX26_01575 in Acinetobacter radioresistens SK82

Annotation: Nitrate/nitrite transporter NrtP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 52 (52 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 245 to 270 (26 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 317 to 334 (18 residues), see Phobius details amino acids 340 to 364 (25 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 359 (330 residues), 96.2 bits, see alignment E=1e-31 amino acids 267 to 437 (171 residues), 36.5 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 90% identity to aci:ACIAD1911)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>MPMX26_01575 Nitrate/nitrite transporter NrtP (Acinetobacter radioresistens SK82)
MSSNLNAKKATKISLFNFSTAAMRAFHMSWLAFFVCFFAWFACAPLMPVIAGEFHLTKDQ
IANINIAAVAITILVRLIVGPLCDKYGPRKTYTALLIIGSLPVFGVASANSYESFLFFRL
LIGAIGASFVITQYHTSIMFASNVVGTANAATAGWGNAGGGATQALMPLLLAALVMFGVE
QTLGWRIALIVPGIMMIIVGALYWKFTQDCPQGNFKELRAAGVQVGSEKKGGMAILLHAA
RNYRVWILFGAYAACFGIEIFIHNIVAMYYVEHFSFGLKEAGMAAGIFGLLALFARALGG
IVSDKVAIKKGLDGRTKVLFAMILMEGLFLILFSQMNSAMLAILVMTIFALFTHMACGAT
YALVPFIDRDALGGVAGIIGAGGNVGAVAAGFLLKGMLDIQTCLMMLGGLVVIAASFVLM
IRFSVEHKAKEQKLFEDAVLERNKTA