Protein Info for MPMX26_01570 in Acinetobacter radioresistens SK82

Annotation: GTP 3',8-cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 14 to 350 (337 residues), 363.8 bits, see alignment E=3.9e-113 PF04055: Radical_SAM" amino acids 26 to 186 (161 residues), 111.4 bits, see alignment E=8e-36 PF13353: Fer4_12" amino acids 30 to 138 (109 residues), 31.6 bits, see alignment E=2.9e-11 PF06463: Mob_synth_C" amino acids 193 to 299 (107 residues), 98.7 bits, see alignment E=3.7e-32

Best Hits

Swiss-Prot: 45% identical to MOAA_STRCO: GTP 3',8-cyclase (moaA) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 69% identity to aci:ACIAD1906)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>MPMX26_01570 GTP 3',8-cyclase (Acinetobacter radioresistens SK82)
MKTMTQLENVALFVDQFGRSKRKLRISVTDRCNFKCVYCMPEHPEWMKKQDLLSFEELYQ
FCDFMVRHGIEAIRITGGEPLMRQGVVHFVEQLQALRKLGLKRISMTTNGHYLKQYADNL
KQAGLDDLNISLDSLNNKQFKQLTQKDLTPVLEGIQAVKAAGLPIKINCVLMNGINDHQI
LPLARWSVQQKIMLRFIEFMPLDGDRKWSTEHVVSEKYILETLATEFTLTEKNNDSAQSG
SEPARQYLIDGHPIGIISTITNSFCGSCDRLRLTAQGEFYNCLFAPQGLNIKNEIRSLGS
SLPLGEVNLYSILSPYIWNKEQGFYAIAQRLKSQNMNQNSRKISMHMIGG