Protein Info for MPMX26_01565 in Acinetobacter radioresistens SK82

Annotation: Molybdate-binding protein ModA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13531: SBP_bac_11" amino acids 23 to 249 (227 residues), 169.4 bits, see alignment E=1.1e-53 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 28 to 248 (221 residues), 179.9 bits, see alignment E=3.3e-57 PF01547: SBP_bac_1" amino acids 29 to 109 (81 residues), 34.1 bits, see alignment E=3.1e-12 amino acids 124 to 234 (111 residues), 39.6 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 40% identical to MODA_XANAC: Molybdate-binding protein ModA (modA) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 61% identity to aci:ACIAD1901)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MPMX26_01565 Molybdate-binding protein ModA (Acinetobacter radioresistens SK82)
MKKILFSYMCLTLTFSSTQAGTVKIYAAASLNNAMTEIAKIYQAQYPQTKIVTVFGGSST
LAKQIEAGASSDLFFSADQEWMAYLVRKNKIHADQVRPLLGNQLVMISPKYLHIPFKPQP
DFKIAKVFNGYLCTAQMETVPAGKYAKQALTRLRWLNDLKGRIVGTDDVRSTLTFVERGE
CKLGIVYKTDALISQKVKILGIFPEHLHNPVIYPLALTKAGSNSPEAVRFQKFIVESIQS
KTIFHHYGFSLKP