Protein Info for MPMX26_01550 in Acinetobacter radioresistens SK82

Annotation: Methylmalonate-semialdehyde dehydrogenase [acylating]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 161 to 180 (20 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details TIGR01722: methylmalonate-semialdehyde dehydrogenase (acylating)" amino acids 13 to 488 (476 residues), 744.8 bits, see alignment E=1.9e-228 PF00171: Aldedh" amino acids 20 to 484 (465 residues), 482.7 bits, see alignment E=5e-149

Best Hits

Swiss-Prot: 62% identical to MMSA_AEDAE: Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial (AAEL001134) from Aedes aegypti

KEGG orthology group: K00140, methylmalonate-semialdehyde dehydrogenase [EC: 1.2.1.27] (inferred from 90% identity to acd:AOLE_18820)

MetaCyc: 69% identical to methylmalonate-semialdehyde dehydrogenase subunit (Burkholderia cepacia R34)
Methylmalonate-semialdehyde dehydrogenase (acylating). [EC: 1.2.1.27]

Predicted SEED Role

"Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.2.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>MPMX26_01550 Methylmalonate-semialdehyde dehydrogenase [acylating] (Acinetobacter radioresistens SK82)
MNTMTNIQTTTAKLLINGQFVESTTSEWQDIINPATQEVVGRVPMATPDEVEAAINAAQD
AFKSWRLTPIQARMRIMLKLQDLIRDNMKEIAHVLTTEQGKTLADAEGDIQRGLEVVEHA
CSIGTLQMGEYAEGVARGVDTYTLQQPLGVCAGITPFNFPAMIPLWMFPMAIVCGNTFVL
KPSEQDPLSTMMLVELAVQAGIPAGVLNVVHGGKDVVDRLCTHQYIKAVSFVGSTAVGTH
VYNLAGQHGKRVQSMMGAKNHVAVMPDANKEQTLNALVGAAFGAAGQRCMALSVAVMVGE
SKNWIHDLVEKAKMLSVNAGHEPNTDIGPVISKRAKARVVELINSGVEEGAELLLDGRDV
EVKGYENGNFVGATIFNHVSTDMRIYKEEIFGPVLSIICVDTLEEAIELINANPFGNGVG
LFTQSGATARTFQNMIDIGQVGINIPIPVPVPFFSFTGSRGSKLGDLGPYGKQAVQFYTQ
TKTITSRWFEDTQEAGEVNTTISLR