Protein Info for MPMX26_01510 in Acinetobacter radioresistens SK82

Annotation: Cobalt-zinc-cadmium resistance protein CzcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 82 to 400 (319 residues), 148.6 bits, see alignment E=1e-47 PF25917: BSH_RND" amino acids 108 to 245 (138 residues), 32 bits, see alignment E=3.3e-11 PF25973: BSH_CzcB" amino acids 108 to 246 (139 residues), 64 bits, see alignment E=3.3e-21 PF25919: BSH_CusB" amino acids 109 to 246 (138 residues), 43.2 bits, see alignment E=1e-14 PF25885: HH_EMRA" amino acids 120 to 208 (89 residues), 35.9 bits, see alignment E=2.9e-12 PF25893: HH_CzcB" amino acids 146 to 205 (60 residues), 59.1 bits, see alignment E=1.2e-19 PF25954: Beta-barrel_RND_2" amino acids 252 to 326 (75 residues), 35.1 bits, see alignment E=4.3e-12 PF25975: CzcB_C" amino acids 334 to 400 (67 residues), 50.9 bits, see alignment E=4.1e-17

Best Hits

KEGG orthology group: None (inferred from 52% identity to aci:ACIAD3376)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>MPMX26_01510 Cobalt-zinc-cadmium resistance protein CzcB (Acinetobacter radioresistens SK82)
MNLKQYGKLSQPLMIAILIALTVLVSLIIWLNKQETRTAEHGHENEHTGDVKDEAHATEE
HVKEKEGEIKLTARQMAEQGLKVAIVTTGPVEEVTLLPGKLVVNTDQQAHVSPSFSGHVE
QVKVSLGQSVQKGQTLAVLLVPELIDQQANLRMAQANLQLAKQDYQREQQLWTQGISAKQ
DYQRAENAYRQAQLAVQASQARLNALGASSNTHGRFVIRAPISGVISQKDIVVGENVQLA
DQIFVIEQLNNLWLEFTLPAQYAGPIQAGQKVLFKLMGTEQTYTARIQSLTSQADSQTGR
LIVRAKLDTQSASLRPNVLVSVLMAKPAAKTSLRVKKAAVQRIEGEDTVFILQSEEKGQV
HLKAQQVKLGQASGDGEWLEVISGLANGEKYISEGSFLLKSELEKDEAGHEH