Protein Info for MPMX26_01492 in Acinetobacter radioresistens SK82

Annotation: Serine/threonine transporter SstT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 311 to 315 (5 residues), see Phobius details amino acids 317 to 372 (56 residues), see Phobius details PF00375: SDF" amino acids 10 to 394 (385 residues), 222 bits, see alignment E=6.7e-70

Best Hits

Swiss-Prot: 78% identical to SSTT_ACIBT: Serine/threonine transporter SstT (sstT) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 77% identity to abc:ACICU_01584)

MetaCyc: 60% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium/dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>MPMX26_01492 Serine/threonine transporter SstT (Acinetobacter radioresistens SK82)
MFSYLFRLSLVTQIVIAIILGMLVTWLFPQAAPYLSLLGDLFIKALKSVAPILVFVLVMA
SIANFKLGQTAHIKPILMMYMVGMLLAAFSAVFASLMFPSTLFLDVPSQLEVQAPGGLGE
ILKNLLLSFIANPVVALSEANFIGILAWSVILGLAFRHASETSRVVLTDVSNAISKVIAI
VIRFAPLGIFGLVAATFADAGLKTLESYAQLLAVLLGTMLFVALIINPLLVAVVTRSNPY
PLVLTCLRESAITAFFTRSSAANIPVNLDLARRLGVNEATASVSIPLGATINMAGAAVTI
TVLTLATVHTLGIPVSLSTMLILSVVATVSACGASGVAGGSLLLIPVACGLFGISSEIAM
QVVAIGMVISVLQDSTETALNSSTDVLFTAAVDRGMR