Protein Info for MPMX26_01482 in Acinetobacter radioresistens SK82

Annotation: Putative multidrug export ATP-binding/permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 298 to 320 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 42 to 309 (268 residues), 57.7 bits, see alignment E=1.6e-19 PF00005: ABC_tran" amino acids 377 to 530 (154 residues), 119.8 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 55% identical to Y1051_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_1051 (HI_1051) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 79% identity to acd:AOLE_10970)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (618 amino acids)

>MPMX26_01482 Putative multidrug export ATP-binding/permease protein (Acinetobacter radioresistens SK82)
MLKWFEKRVDAYPTEGLYEPLPRRFFPFIWQATKGLRPYIFLLVLVTAGAASFEALLYSK
IGQLVDWLGTSQPDTFYVNHETNLLILASFLFANIFFASMQSIVKHQILYSNFPMRLRWR
FHNFLLQQSLDFFHNDFAGRLSAKVMQTALAVREFWVILGDMMAYVVVYFTTISIVFIGI
SPVLMIPLLVWLLLFMIAAYYFIPRLGKVSKQQADARAVMTGRVTDAYTNIQTVKLFAHA
GRESRYAKESMMEFMVTVYRQMRLGAKFEISVNMLSAVLFLGVLGTAIHLWVEGKAGLGV
VAATTAMIMKLNSMAFFIMWQISALFENIGTIQDGMGTLSRPVEIQDKKNAKPLKVTAGE
IRFDNVSFAYNEKNVIDQLNLTIRPGEKIGIVGRSGAGKSTLIQLLLRFYTIQNGRILID
GQDIQNVTQDSLRANIALVTQDTSLLHRSVSENIKYGRPDATDEEMYEAVRKAQAETFIP
QLTDLGGRRGYDAQVGERGVKLSGGQRQRIAIARVFLKDAPILILDEATSALDSEVEAAI
QSSLDALMTGKTVIAIAHRLSTIAQMDRLIVLDQGRIAEQGTHEQLIQQNGIYAQLWQRQ
TGGFLVEQQIPKKVEDTE