Protein Info for MPMX26_01462 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 299 to 319 (21 residues), see Phobius details PF01636: APH" amino acids 37 to 263 (227 residues), 160.7 bits, see alignment E=2.7e-51

Best Hits

KEGG orthology group: K06979, (no description) (inferred from 82% identity to acd:AOLE_08490)

Predicted SEED Role

"POSSIBLE ACYL-COA DEHYDROGENASE FADE36"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>MPMX26_01462 hypothetical protein (Acinetobacter radioresistens SK82)
MTVIDVGGQIKKGEELDIEAVEQWLKQQGIDLQGKVEVTQYSGGASNWTYRLKYENLDLI
LRRPPKGTKAKSAHDMVREYTVQKNLAPYYPVVPEMVALCEDESVIGCDFYVMKRIEGII
PRAKLPPELQLGEAQVHELCINVIDKLIELHQVPYQGTELEKLGKGEGYCRRQVEGWDKR
YEKARTINVPSFKYVRKWLLDNIPEDSETCLIHNDWRFDNVVLSPQQPTQVIGVLDWEMA
TLGDPLMDLGSALAYWVEPTDNMIFRSTRRQPTHLPGMFSRKQVVEYYLDKTGLKPDNWT
FYEVFGIFRLAVIAQQIYYRYFHRQTRNPAFKNFWIIIQALHVRALKLIAQQKIHENPLA
QKYVHKLQEILKK