Protein Info for MPMX26_01408 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF04233: Phage_Mu_F" amino acids 49 to 158 (110 residues), 78.7 bits, see alignment E=3e-26 TIGR01641: phage head morphogenesis protein, SPP1 gp7 family" amino acids 58 to 160 (103 residues), 56.3 bits, see alignment E=1.9e-19

Best Hits

Predicted SEED Role

"COG2369: Uncharacterized protein, homolog of phage Mu protein gp30"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>MPMX26_01408 hypothetical protein (Acinetobacter radioresistens SK82)
MKPVTFLEALQFARSRKIVLPDEFYSLDLKTRQLATTVSFLSSIEQIQTVIAAVNKAIAD
GSTFEDFKKLVAENEIKLSEPYLKNVFRTNIQTAYSHGRWQQQQRNRDKRPYLMYSAIDD
SRVRPSHLALNRIIRHIDDPFWLMYYPPWGFMCRCTVIALTEKQAEKYGITPDDQLPEVA
EEMGWSTSPMTYGDLSGLVDQKILDSDLDKAFLLEQKEIIKAEWTASKKLASLFAPMDEQ
SRDLFKTIVETVLPLDPEIRPSTIKTFLDYVQGNDSALTAQLNQPPVTLAEEVLKRWLKE
DLGRLQAVASNSTATVAGSASLTYAASLEVGKVITLDAPLLLAGSGSNIVIQIENAKGLG
IDLDKLNAGQGVLFPLGISFQVVSRETVEGQIVYLLKALRN