Protein Info for MPMX26_01353 in Acinetobacter radioresistens SK82

Annotation: 7-alpha-hydroxysteroid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 11 to 202 (192 residues), 159.7 bits, see alignment E=1.3e-50 PF08659: KR" amino acids 12 to 175 (164 residues), 41.6 bits, see alignment E=2.6e-14 PF01370: Epimerase" amino acids 13 to 192 (180 residues), 25.9 bits, see alignment E=1.3e-09 PF13561: adh_short_C2" amino acids 18 to 251 (234 residues), 190.1 bits, see alignment E=9.8e-60

Best Hits

Swiss-Prot: 47% identical to HDHA_ECOLI: 7-alpha-hydroxysteroid dehydrogenase (hdhA) from Escherichia coli (strain K12)

KEGG orthology group: K00076, 7-alpha-hydroxysteroid dehydrogenase [EC: 1.1.1.159] (inferred from 79% identity to acb:A1S_3474)

MetaCyc: 67% identical to 7alpha-hydroxysteroid dehydrogenase (Stenotrophomonas maltophilia)
7-alpha-hydroxysteroid dehydrogenase. [EC: 1.1.1.159]; 1.1.1.159 [EC: 1.1.1.159]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.159

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>MPMX26_01353 7-alpha-hydroxysteroid dehydrogenase (Acinetobacter radioresistens SK82)
MYQSLLDLSGKTALVTGGAAGIGRACASLLAEAGANVMIADLNLEAAQQTAEYIKEQTGG
DIRSIACNILKDSELVGAVESTLEAFGHIHILVNNAGGGGGGHEAPDQISVDDFVRDFQL
NVFAAWRLCQLVVPHMNIAGYGSIVNITSMSSVNKSPAMSGYAASKAALNHMGANLAHDF
GPVVRINAVGPGAIRTAALAKVLTPEIEKRMLAHTPLQRLGEPEDIAKAVLFFAAPISSW
ISGQTLFVNGGGVQTLD