Protein Info for MPMX26_01333 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF00583: Acetyltransf_1" amino acids 42 to 137 (96 residues), 63.8 bits, see alignment E=2.6e-21 PF13673: Acetyltransf_10" amino acids 43 to 145 (103 residues), 38.3 bits, see alignment E=1.8e-13 PF13508: Acetyltransf_7" amino acids 51 to 138 (88 residues), 53 bits, see alignment E=5.8e-18

Best Hits

Swiss-Prot: 54% identical to YJGM_ECOLI: Uncharacterized N-acetyltransferase YjgM (yjgM) from Escherichia coli (strain K12)

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 58% identity to yep:YE105_C0509)

MetaCyc: 54% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

"COG0454: Histone acetyltransferase HPA2 and related acetyltransferases"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>MPMX26_01333 hypothetical protein (Acinetobacter radioresistens SK82)
MFNLRLIQSKDNPSIAQIIRTVSQEFGLASDAGFAVSDPILDDLYQVYQEPNSRYWVVES
TQGKIVGGGGIAPLQGDTSILEIQKMYFLPETRGYGLAKQLLQQCFEFAQQQNFQTIYLE
TTATLYQAVKLYERLAFERLDQPLGNTGHSNACEIWMAKKLAY