Protein Info for MPMX26_01217 in Acinetobacter radioresistens SK82

Annotation: Biopolymer transport protein ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 70 to 186 (117 residues), 105.2 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 69% identity to abc:ACICU_01600)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>MPMX26_01217 Biopolymer transport protein ExbB (Acinetobacter radioresistens SK82)
MWELVKAGGWLMLPLVVCSIFTIAITLERFIRLKRSQVIPVELILRHPQDIAPVIDRLSH
APNLQASTLGQILLTGYASRQESEQFARAQMEAKASQEIGYLEKNINFLGTLSAVAPLIG
LLGTVLGIIESFLVIDLGTTSNPGLMIPGISKALITTAAGMLIAIPALFAYRFFQRLVQE
YVAELEQQSTLFHAALFYSSTAGSELRKVS