Protein Info for MPMX26_01202 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 54 to 71 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 115 to 148 (34 residues), see Phobius details PF04284: DUF441" amino acids 10 to 148 (139 residues), 152.3 bits, see alignment E=4.4e-49

Best Hits

Swiss-Prot: 82% identical to Y2383_ACIAD: UPF0756 membrane protein ACIAD2383 (ACIAD2383) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 82% identity to aci:ACIAD2383)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>MPMX26_01202 hypothetical protein (Acinetobacter radioresistens SK82)
MMSQLDVNLMVLLVLLACGIFSHNTAVTIAAGILIVFKMTPLEQFFPYLQQHGLNIGIII
LTIGVLTPIASGKIPGESILKSFLSLKSLLAIGIGLLVAWLGGRGVKLMSNQPDVVAGLL
IGTVAGVAVLRGVPVGPLIAAGLLSIIIGTS