Protein Info for MPMX26_01155 in Acinetobacter radioresistens SK82

Annotation: 50S ribosomal protein L9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00158: ribosomal protein bL9" amino acids 1 to 148 (148 residues), 165.3 bits, see alignment E=6.6e-53 PF01281: Ribosomal_L9_N" amino acids 1 to 45 (45 residues), 77 bits, see alignment E=6.5e-26 PF03948: Ribosomal_L9_C" amino acids 63 to 146 (84 residues), 93.5 bits, see alignment E=8.6e-31

Best Hits

Swiss-Prot: 95% identical to RL9_ACIBT: 50S ribosomal protein L9 (rplI) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 94% identity to aci:ACIAD2432)

MetaCyc: 63% identical to 50S ribosomal subunit protein L9 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (148 amino acids)

>MPMX26_01155 50S ribosomal protein L9 (Acinetobacter radioresistens SK82)
MDVILLQRIKNLGKLGDKVSVKAGYGRNFLIPQGKAVAATEANTSAFEARRAELEKQEAD
ILAAAQARADQLNEVNIVITAKAGDEGKLFGSIGTRDIADALTNAGLEVDRAEVRLPNGA
LRNTGEFNIAIQLHHDVTAEVLVTIVSE