Protein Info for MPMX26_01147 in Acinetobacter radioresistens SK82

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 618 (612 residues), 901.3 bits, see alignment E=1.5e-275 PF00890: FAD_binding_2" amino acids 8 to 38 (31 residues), 21.7 bits, see alignment (E = 2.6e-08) PF01134: GIDA" amino acids 8 to 398 (391 residues), 568.4 bits, see alignment E=2.2e-174 PF12831: FAD_oxidored" amino acids 8 to 149 (142 residues), 34.1 bits, see alignment E=5.1e-12 PF21680: GIDA_C_1st" amino acids 460 to 552 (93 residues), 79.1 bits, see alignment E=8.9e-26 PF13932: GIDA_C" amino acids 558 to 613 (56 residues), 81.6 bits, see alignment 7e-27

Best Hits

Swiss-Prot: 95% identical to MNMG_ACIBS: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Acinetobacter baumannii (strain SDF)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 95% identity to abm:ABSDF1520)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (626 amino acids)

>MPMX26_01147 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (Acinetobacter radioresistens SK82)
MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMSCNPAIGGIGKSHLV
REIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRILYKAAIRNVLENQTNLDI
FQQAADDLIVEGDTVKGVVTQMGIRFDTKTVVLTTGTFLGGVIHVGLEKSSGGRAGDPPS
ISLAHRLRELKLPVGRLKTGTPPRIDARSVDFSVMTPQPGDFPSPTMSFMGDASMHPEQV
NCYITHTNEKTHEIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFADKDSHQVFLEPE
GLDTHELYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIEYDYFNPQALKFTLETK
AINNLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQEEWTPKRDQAYIGVLVDDLITL
GTKEPYRMFTSRAEYRLMLREDNADQRLTPVGREMGLVDDVRWAAYCEKMEAVERETSRL
QHLWAAPNNPMGKKFVEMTGQDLSKESSAIDLLKRPNVTFEQIAELTDSEVTQQVGDQIE
IAVKYAGYINRQHEDVAQMKRLEETRIPADFNYDVVSGLSREITQKLKTVLPETLAQASR
IPGVTPAAVQLIMITIRKNAQIKKTA