Protein Info for MPMX26_01130 in Acinetobacter radioresistens SK82

Annotation: Beta-lactamase OXA-133

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00905: Transpeptidase" amino acids 48 to 263 (216 residues), 131.4 bits, see alignment E=2e-42

Best Hits

Swiss-Prot: 98% identical to BL133_ACIRA: Beta-lactamase OXA-133 (blaOXA-133) from Acinetobacter radioresistens

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 98% identity to abn:AB57_0551)

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>MPMX26_01130 Beta-lactamase OXA-133 (Acinetobacter radioresistens SK82)
MNKYFTCYVVASLFLSGCTVQHNLINETQSQIVQGHNQVIHQYFDEKNTSGVLVIQTDKK
INLYGNALSRANTEYVPASTFKMLNALIGLENQKTDINEIFKWKGEKRSFTAWEKDMTLG
EAMKLSAVPVYQELARRIGLDLMQKEVERIDFGNTEIGQQVDNFWLVGPLKVTPIQEVEF
VSQLAHTQLPFSEKVQANVKNMLLLEESNGYKIFGKTGWAMDIKPQVGWLTGWVEQPDGK
IVAFALNMEMRSEMPASIRNELLMKSLKQLNII