Protein Info for MPMX26_01099 in Acinetobacter radioresistens SK82

Annotation: Aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00670: aspartate carbamoyltransferase
  • amino acids 21 to 323 (303 residues), 299.5 bits, E=1.2e-93
• PF02729: OTCace_N
  • amino acids 21 to 164 (144 residues), 144.8 bits, E=2.1e-46
• PF00185: OTCace
  • amino acids 173 to 321 (149 residues), 105.5 bits, E=3.1e-34

Best Hits

Swiss-Prot: 90% identical to PYRB_ACIAD: Aspartate carbamoyltransferase (pyrB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 90% identity to aci:ACIAD1270)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Protein Sequence (338 amino acids)

>MPMX26_01099 Aspartate carbamoyltransferase (Acinetobacter radioresistens SK82)
MHLAALHTPSQIQLNQYGHLKHFLTIEGLSQQTLIKILDTASSFFNDQNQLITSPLLEGR
TVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADLFV
VRHSSSGAAHFIAKDVCPNIGIINAGDGRHAHPTQAMLDMLTIRRETARPFEELSVAIIG
DIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPFGFKEFGPEVRLFNNMDEGVKDCDVII
ALRIQNERIDSPALSSQSEFYKMYGLNEDRLALAKPDCIVMHPGPMNRGVEIDSSIADGP
QSVILRQVTNGIAVRMAVLALTMQGQLEEKGLIEALAI