Protein Info for MPMX26_01097 in Acinetobacter radioresistens SK82

Annotation: Ribosomal RNA large subunit methyltransferase K/L

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 PF22020: RlmL_1st" amino acids 11 to 64 (54 residues), 63.5 bits, see alignment 5e-21 PF02926: THUMP" amino acids 82 to 154 (73 residues), 50.4 bits, see alignment E=8.8e-17 PF01170: UPF0020" amino acids 175 to 384 (210 residues), 126.4 bits, see alignment E=4.2e-40 PF02384: N6_Mtase" amino acids 195 to 335 (141 residues), 23 bits, see alignment E=1.6e-08 PF10672: Methyltrans_SAM" amino acids 507 to 688 (182 residues), 58.8 bits, see alignment E=1.8e-19 PF03602: Cons_hypoth95" amino acids 561 to 652 (92 residues), 24 bits, see alignment E=9.6e-09

Best Hits

Swiss-Prot: 86% identical to RLMKL_ACIBY: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Acinetobacter baumannii (strain AYE)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 86% identity to abb:ABBFA_002388)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (734 amino acids)

>MPMX26_01097 Ribosomal RNA large subunit methyltransferase K/L (Acinetobacter radioresistens SK82)
MNASQRLSTYWVTCADGLELLLEEEIAQLGASNVERKPGRLVFQGSLETAYRICMWSRLA
SRVLLPIHTQEIEFSHDARDVAEELYDGALSFDWSLIFAPQSTFAIRLHVERDIKVNTQF
ATLRVKDGVVDAFMEAVGRRPSIDTKQPEITLYVLAGKTEHTYCLDLSGDSLHKRGYRRY
MTDAPIKENLAAAILHKAGIEKRKPDIILDPMCGSGTFIIESLMILTDRAPGLVRRFGFN
GWHGHDRELWMSLKAEAVERHEQALEQPLPKFYAFDADWEAVKATRQNIAAAGFEKQLEQ
IQVEERTLADWPEFDATEKTAFIVTNPPYGERLGEKASNRALYLGLSGQLQKHFPNQYAA
IIAAQVEQADVLAFEHPETLRLMNGKLPIYIRFGTIKPASDNIPFLEKWQPQNVEIEGAQ
DFANRLQKNMQTLKKWATKDRVFCLRLYDADLPDFNVAVDLYGDRLHVQEYAPPKTIDPE
KAKKRFNLALAAIRTVTGLGRDAIFIKTRARQAGKAQYEKQSTASKRFIVQEGQARILVN
LTDYLDTGLFLDHRQMRLRIAREAKGKHFLNLYSYTSTASLHAALGGAASTTSVDLSNTY
LNWSKENFVLNGLTVDHPDQQHQFFASDCFEWLKEGHEQYDMIFIDPPTFSNSKKFYGTF
DVQRDHVSLLKRAMNRLTTEGTLYFSNNYRGFEMDEEIEAMFDIEEITQETIGPDFKRNQ
KIHRAWKIQHYPVN