Protein Info for MPMX26_00985 in Acinetobacter radioresistens SK82

Annotation: Anthranilate synthase component 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase
  • amino acids 1 to 191 (191 residues), 273 bits, E=6.6e-86
• PF00117: GATase
  • amino acids 3 to 190 (188 residues), 200 bits, E=3e-63
• PF07722: Peptidase_C26
  • amino acids 70 to 175 (106 residues), 33.7 bits, E=3.4e-12

Best Hits

Swiss-Prot: 89% identical to TRPG_ACIAD: Anthranilate synthase component 2 (trpG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 91% identity to acd:AOLE_05260)

MetaCyc: 65% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27) @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" (EC 2.6.1.85, EC 4.1.3.27)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
• acridone alkaloid biosynthesis (1/4 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
• chloramphenicol biosynthesis (1/9 steps found)
• superpathway of chorismate metabolism (36/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Folate biosynthesis
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85, 4.1.3.27

Use Curated BLAST to search for 2.6.1.85 or 4.1.3.27

Protein Sequence (194 amino acids)

>MPMX26_00985 Anthranilate synthase component 2 (Acinetobacter radioresistens SK82)
MLLMIDNYDSFTYNIVQYFGELNQEVKVVRNDSVTLDDIERWQPKYLVIGPGPCSPTEAG
ISIPAIQHFAGKIPLLGVCLGHQSIGQAFGGKIIRAKTVMHGRLSDMYHNDTGIFSHLPS
PFSATRYHSLVIDQASLPDCLEVNCWTKEADGSMEEIMGVKHKTLPVEGVQFHPESILSQ
HGHKIFQNFLEIYA