Protein Info for MPMX26_00980 in Acinetobacter radioresistens SK82

Annotation: Diguanylate cyclase DosC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF11563: Protoglobin" amino acids 25 to 156 (132 residues), 52 bits, see alignment E=1.3e-17 PF21118: DosC_2nd" amino acids 181 to 284 (104 residues), 69.7 bits, see alignment E=3.6e-23 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 293 to 451 (159 residues), 143.6 bits, see alignment E=2.4e-46 PF00990: GGDEF" amino acids 294 to 448 (155 residues), 141.5 bits, see alignment E=3.2e-45

Best Hits

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>MPMX26_00980 Diguanylate cyclase DosC (Acinetobacter radioresistens SK82)
MNEQCITMLAEQWKDICGQYSATDLNYTAQFIQDNSFLLVDEFYKNMMQEKEASYFLSDE
IVQSRLKTTLNQWLLDCFNMPFKQNYEEVVQRQLVIGNVHARIGIPSWLIMRGIREIEKK
VFSLQASRTQQNIYAVTNYIVQSIGFASEIMCRSYEANIEINNDIKHTYRLFSAMQDVSI
QKDKQRSSLLDWENELMFKVFSDSASFNHLLLSKSEFGLWFIHKAAYAFSGTDQVQIIID
RIYEVDKLNLAVLESQDKANAIALIQRIREKNREIQHLVDQLFQVSEYIGSGNDSLTQLL
NRRYLNTIINREINFSRKNGSPLTLLAIDADHFKGINDKFGHAAGDLALQFLAEVLLECT
KGSDYAFRIGGEEFLLLLVDSDLSRAQSVAENIRMRIEETVIRSTMGVSFNFTVSVGAVL
YDGHPDYQRFLDAADSALYAAKNNGRNNVYMG