Protein Info for MPMX26_00953 in Acinetobacter radioresistens SK82

Annotation: FMN reductase (NADH) RutF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF01613: Flavin_Reduct" amino acids 11 to 160 (150 residues), 125.8 bits, see alignment E=8e-41

Best Hits

Swiss-Prot: 56% identical to RUTF_PANAM: FMN reductase (NADH) RutF (rutF) from Pantoea ananatis (strain LMG 20103)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 68% identity to abn:AB57_0783)

MetaCyc: 51% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.-, 1.5.1.42

Use Curated BLAST to search for 1.5.1.- or 1.5.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (167 amino acids)

>MPMX26_00953 FMN reductase (NADH) RutF (Acinetobacter radioresistens SK82)
MVETTDFRNGMSLLTGAVNVITTAGETGRFGFTASAVCSVTDTPPTLLVCMNRSSSSHCH
FKDNGILSVNVLGAHHQQISQAFASRIPMDERFTHGEWTTLLTGSPVLSDALVSFDCRIR
QMNDVGTHTIFYCEVEAIKMNENKESCHGLIYFNRCYHHIGQQEYKL