Protein Info for MPMX26_00895 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 PF13185: GAF_2" amino acids 23 to 163 (141 residues), 43.8 bits, see alignment E=1.4e-14 PF01590: GAF" amino acids 66 to 162 (97 residues), 40.7 bits, see alignment E=1.6e-13 TIGR00229: PAS domain S-box protein" amino acids 176 to 292 (117 residues), 58.5 bits, see alignment E=7.3e-20 amino acids 292 to 415 (124 residues), 66.4 bits, see alignment E=2.7e-22 PF00989: PAS" amino acids 178 to 285 (108 residues), 28 bits, see alignment E=8.5e-10 amino acids 298 to 409 (112 residues), 55.3 bits, see alignment E=2.9e-18 PF08448: PAS_4" amino acids 186 to 287 (102 residues), 29 bits, see alignment E=5e-10 amino acids 302 to 413 (112 residues), 29.2 bits, see alignment E=4.4e-10 PF13426: PAS_9" amino acids 187 to 286 (100 residues), 27.8 bits, see alignment E=1.2e-09 amino acids 306 to 411 (106 residues), 62.8 bits, see alignment E=1.5e-20 PF13188: PAS_8" amino acids 302 to 347 (46 residues), 22 bits, see alignment 5.3e-08 PF08447: PAS_3" amino acids 322 to 405 (84 residues), 34.6 bits, see alignment E=8.4e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 420 to 578 (159 residues), 96.5 bits, see alignment E=1.5e-31 PF00990: GGDEF" amino acids 424 to 575 (152 residues), 113.3 bits, see alignment E=4.4e-36 PF00563: EAL" amino acids 598 to 832 (235 residues), 239.3 bits, see alignment E=1.8e-74

Best Hits

KEGG orthology group: None (inferred from 36% identity to kko:Kkor_0358)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (849 amino acids)

>MPMX26_00895 hypothetical protein (Acinetobacter radioresistens SK82)
MRESYDTYHIFSLIGQHAELEPILNAISGWLESHIPDALVTIMLYSEHDQTLKLISGKQH
FSNQYCKAVNNLKIGPQRGACGTAAFLRKLVISQDLMEDPNWAAYRALVKAEQLSSCWSM
PIINARNILYGTFGTYYRTPKKPTKHNIRLLEQAASLVALAIELDDERQQKIAINEKYSS
FYNYHPDVILELDLQGYVLNTNIACREITGFSQEQIQGKHYWTLIPDEYHELVDAAFKSA
LLGKSQHYEIPVYNVIEKIIWLDIINLPIIQNQKVTGVFTIARDISVNRKNKESLRLLKR
GVDASPSGMFITDASENMVISFVNPAFLKQVGYTEEEVIGRNYNFLQGRDTNLEQLALFK
QAVKEQKDVQITLKNYCRDGSWFWNRLMLGPILDQDGKCTHFLGIQEDITQQRIHEEYIE
YQNTHDQLTGLLNQINFEKVLEQTFEKQKLLTLLYIDLDDFSSMNDSLGYYVGNKVIKNI
ASRLKDFLKPDEVLSRYAEDEFVLLIKGQHDHKKITTRAANILDLISEPFQVDDHTLHLS
ASIGIVINNSFIQCASELLYRSTLAMREAKRQGRNTWHCYEESNKISPNLDYAHLRLELM
EAVKKKQFTLFYQPLIKPLTGVVQGVEALIRWYHPERGYIFPDFFIPLAERTGQIVNIGQ
WVLETACLDIAKWNKAHDSQLTVSVNISPLQFGRAGFLEELQKALKISQLPAELLKIEIT
EGVIISGADRAIEILKSIRALGVHVVIDDFGTGYSSLSYLRLLPITQIKLDRSFIVNLTI
SVQDAAIVRSIIFLAHQLNLEVVAEGVETLEQASLLYQQDCDLFQGYFYARPAPISDLNS
KFLPLESLS