Protein Info for MPMX26_00839 in Acinetobacter radioresistens SK82
Annotation: Muconolactone Delta-isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to CATC_PSEPU: Muconolactone Delta-isomerase (catC) from Pseudomonas putida
KEGG orthology group: K03464, muconolactone D-isomerase [EC: 5.3.3.4] (inferred from 67% identity to reh:PHG384)MetaCyc: 62% identical to methylmuconolactone isomerase monomer (Cupriavidus pinatubonensis JMP134)
Muconolactone Delta-isomerase. [EC: 5.3.3.4]
Predicted SEED Role
"Muconolactone isomerase (EC 5.3.3.4)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 5.3.3.4)
MetaCyc Pathways
- superpathway of salicylate degradation (7/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
- catechol degradation to β-ketoadipate (4/4 steps found)
- aromatic compounds degradation via β-ketoadipate (7/9 steps found)
- 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
- mandelate degradation to acetyl-CoA (11/18 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (14/35 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 5.3.3.4
Use Curated BLAST to search for 5.3.3.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (92 amino acids)
>MPMX26_00839 Muconolactone Delta-isomerase (Acinetobacter radioresistens SK82) MLFCVEMTVKIPLDSDPVKMDEIKRAEKERAIDLQKAGKWPHLWRVTGKYSNISIFDVES NNELHDLLMSLPLFPYMDIKVTALSQHPSSIH