Protein Info for MPMX26_00755 in Acinetobacter radioresistens SK82

Annotation: Succinate--CoA ligase [ADP-forming] subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR01019: succinate-CoA ligase, alpha subunit" amino acids 4 to 290 (287 residues), 459.3 bits, see alignment E=2.6e-142 PF02629: CoA_binding" amino acids 6 to 99 (94 residues), 107 bits, see alignment E=1e-34 PF13607: Succ_CoA_lig" amino acids 147 to 283 (137 residues), 38.5 bits, see alignment E=1.4e-13 PF00549: Ligase_CoA" amino acids 153 to 272 (120 residues), 91.1 bits, see alignment E=9.8e-30

Best Hits

Swiss-Prot: 73% identical to SUCD_ECOL6: Succinate--CoA ligase [ADP-forming] subunit alpha (sucD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01902, succinyl-CoA synthetase alpha subunit [EC: 6.2.1.5] (inferred from 92% identity to acd:AOLE_03735)

MetaCyc: 73% identical to succinyl-CoA synthetase subunit alpha (Escherichia coli K-12 substr. MG1655)
Succinate--CoA ligase (ADP-forming). [EC: 6.2.1.5]

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>MPMX26_00755 Succinate--CoA ligase [ADP-forming] subunit alpha (Acinetobacter radioresistens SK82)
MSVLVNKDTKVLVQGFTGKNGTFHSEQAIAYGTKVVGGVTPGKGGQSHLNLPVFNTMREA
VQETQADASVIYVPAPFVLDSIVEAVDAGIGLIVVITEGVPTLDMLKAKRYLETNGNGTR
LIGPNCPGIITPGECKIGIMPGHIHQPGRIGIISRSGTLTYEAVSQTTRLGLGQSTCIGI
GGDPIPGMNQIDALKLFQDDPETDAIIMIGEIGGTAEEEAAEYIQSNVTKPVVGYIAGVT
APKGKRMGHAGAIISGGKGTAEEKFAAFEKAGMAYTRSPAELGSTMLQVLKDKGLA