Protein Info for MPMX26_00696 in Acinetobacter radioresistens SK82

Annotation: Outer-membrane lipoprotein carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 36 to 231 (196 residues), 85.7 bits, see alignment E=1.5e-28 PF03548: LolA" amino acids 49 to 221 (173 residues), 139.2 bits, see alignment E=1.1e-44

Best Hits

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 80% identity to aci:ACIAD2937)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>MPMX26_00696 Outer-membrane lipoprotein carrier protein (Acinetobacter radioresistens SK82)
MNMLRKTICAMTVGAATLAPVISTSVIAAPVAASEQQATANLVQQLKGIQSLSANFEQTT
KVSGNAPKKQKGLTAQHMNQTFKGTMKVERPGKFFWETSSPSKQTIVTTGKTVWIYDPDL
QQAVRQSLDEQVSNTPALLLSGNTSQIMQSYRVTQPNKAKTYYTLYPKNNEGAFQSLTIS
FGTNKAPSLMILEDSLGQTTYVKFSNVKVNASIPASTFNFTPPKGTDIIDQ