Protein Info for MPMX26_00643 in Acinetobacter radioresistens SK82

Annotation: Cell shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 6 to 274 (269 residues), 167 bits, see alignment E=2.6e-53 PF04085: MreC" amino acids 125 to 271 (147 residues), 146.5 bits, see alignment E=2.6e-47

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 91% identity to aci:ACIAD0826)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>MPMX26_00643 Cell shape-determining protein MreC (Acinetobacter radioresistens SK82)
MQPNLFSRQPPSFRSFIIAVITCLIVLFFDWRMPHVVQPAREVLYAAYNPIYALASYPVL
SREWLSQQTKSEAQLRRENTAMQAELLQAQVRLQKLSELSAENTRLRGLLDTPLIIDGRM
EIAEVIGTDADPLRHIIIINRGASNQLKVGQTVLDDRGVMGQIIDVYPHSSRVMLLSDKE
HSLSVRLERTGMRAIVAGTGDLGLLKMEYVPTSADIKPGDKIYTSGLGEHFPAGYLVGTV
SKVRRHNSGEFAQIQVVPAAQLAGGHHVVILFSDSLAMEQPYANR