Protein Info for MPMX26_00642 in Acinetobacter radioresistens SK82

Annotation: Cell shape-determining protein MreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 10 to 337 (328 residues), 484.6 bits, see alignment E=7.4e-150 PF06723: MreB_Mbl" amino acids 13 to 337 (325 residues), 466 bits, see alignment E=1.4e-143 PF00022: Actin" amino acids 37 to 203 (167 residues), 27.4 bits, see alignment E=3.4e-10 PF00012: HSP70" amino acids 98 to 312 (215 residues), 54.8 bits, see alignment E=1.4e-18 PF14450: FtsA" amino acids 161 to 319 (159 residues), 43.8 bits, see alignment E=8.1e-15

Best Hits

Swiss-Prot: 68% identical to MREB_SHIFL: Cell shape-determining protein MreB (mreB) from Shigella flexneri

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 98% identity to acb:A1S_2781)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>MPMX26_00642 Cell shape-determining protein MreB (Acinetobacter radioresistens SK82)
MILKRLIGLFSPDLAIDLGTANTLIYAPGRGIILNEPTVVAIRHSGSQKIVAAVGLDAKQ
MLGRTPANISAIRPMKDGVIADFEVTETMLNQFIGKVHEKRLFPPAPRVVVCVPCKSTLV
ERRAIREAVFNAGARDVRLIEEPMAAAIGAGMPVEQACGSMVVDVGGGTTEIAIISLQGC
VYADSLRIGGDVFDEQIINYVRKAHGCVIGETTAELIKKEVGMAIGDGTTLEIEVRGRNL
AEGVPRSITVTSDEITQAIADPLSNIVSAVKSALEQTPPELSSDIAERGIVLTGGGALLR
NLDKLLAQETGLPVMVAEDPLTCVTRGGGKVLEFFDNPNHDMLFVG