Protein Info for MPMX26_00632 in Acinetobacter radioresistens SK82

Annotation: Acyl-CoA dehydrogenase, short-chain specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF02771: Acyl-CoA_dh_N" amino acids 14 to 123 (110 residues), 145.4 bits, see alignment E=1.7e-46 PF02770: Acyl-CoA_dh_M" amino acids 127 to 222 (96 residues), 95.9 bits, see alignment E=2.7e-31 PF00441: Acyl-CoA_dh_1" amino acids 234 to 385 (152 residues), 128 bits, see alignment E=7.1e-41 PF08028: Acyl-CoA_dh_2" amino acids 255 to 368 (114 residues), 47.9 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 64% identical to IVD_RAT: Isovaleryl-CoA dehydrogenase, mitochondrial (Ivd) from Rattus norvegicus

KEGG orthology group: K00253, isovaleryl-CoA dehydrogenase [EC: 1.3.99.10] (inferred from 85% identity to acd:AOLE_11845)

MetaCyc: 68% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.4 or 1.3.99.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>MPMX26_00632 Acyl-CoA dehydrogenase, short-chain specific (Acinetobacter radioresistens SK82)
MNLQTIDFGIDNTLKALQESVQNFAKKEVAPLAAKADQDNLFPAQLWKKMGDMGLLGMTV
SEEYGGSNMGYLAHILVMEEISRASASIGLSYGAHSNLCINQIHRHGTEAQKQRYLPKLV
SGEYVGALAMSEPNAGSDVVSMTLRADQKGDHYVLNGSKMWITNGGDADVLVVYAKTDLQ
AGAKGMTAFLIEKDMKGFSHGQHLDKLGMRGSNTYPLFFDDCKVPAENVLGGVGNGVKVL
MSGLDYERAVLSGGPLGIMDACLDIVMPYLHERKQFGQALGEFQLMQGKIADMYSTWLAC
KALVYSVGQACDRADHGRALRKDAASAILYSAEKATWMAGEAIQTLGGNGYINDFATGRL
WRDAKLYEIGAGTSEIRRMLIGRELFNETA