Protein Info for MPMX26_00603 in Acinetobacter radioresistens SK82

Annotation: Cardiolipin synthase C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 50 to 167 (118 residues), 51.4 bits, E=1e-17
  • amino acids 288 to 442 (155 residues), 80 bits, E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 78% identity to aci:ACIAD3001)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Protein Sequence (499 amino acids)

>MPMX26_00603 Cardiolipin synthase C (Acinetobacter radioresistens SK82)
MPQVPQYAHDIDASQTSLSQIVTPLREQNPGLTGYHVLYDPLEALAARLRLIDKAEKSLD
LQYYIWDNDRIGALALHALIRAADRGVKVRLLIDDNNAKNMEGIYLALSQHKNIEIKLFN
PYRFRKYRAMDMVLDLKRINRRMHNKSFIADHQIALIGGRNMSNQYYNVSETYQFSDVDV
MLVGSAVDDIVHSFDDYWNDDYAYPVKEIVSAQRHHLRYESLKRQLDIHNQEVSVQNYLD
LTNRSKAFDEWLYHKIGFDWVKAEVVKDPPEKIKAKAKKEGLLNFQLLKYLDKPEQSVDL
ISAYFVPEKQGAKMLSQLAEDGIKVRVLTNSYAANDVAVVHAFYAKYRQQLLENGVQLYE
FLPAVTDEELNEVNQEISKKAKVSMKGLSRSSLHAKMMALDEKQVFIGSFNFDPRSAYLN
SEIGVILNSPQLANAVHKTMDENLKKYAYKLVLDANNKLTWEFQPQEPGGKIYHKEPRMK
WWERAGIKALSWLPLEGFM