Protein Info for MPMX26_00591 in Acinetobacter radioresistens SK82

Annotation: Stringent starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF02798: GST_N" amino acids 11 to 78 (68 residues), 53.1 bits, see alignment E=4.9e-18 PF13409: GST_N_2" amino acids 22 to 79 (58 residues), 29.2 bits, see alignment E=1.7e-10 PF13417: GST_N_3" amino acids 25 to 84 (60 residues), 30 bits, see alignment E=8.1e-11

Best Hits

Swiss-Prot: 36% identical to SSPA_PASMU: Stringent starvation protein A homolog (sspA) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K03599, RNA polymerase-associated protein (inferred from 77% identity to acd:AOLE_02485)

Predicted SEED Role

"Stringent starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>MPMX26_00591 Stringent starvation protein A (Acinetobacter radioresistens SK82)
MSLENTPLQGITLYSHADDFRSHWIRLVLAEKQIKYHLVLVDHEDEDLASLNPYNRLPML
VEQDLKLFNTVIISEYIDDRYRQNKLYADAPMQRAEQRQYIWRLEQDWLRLADILLCHSD
TLSQPEQKQARQELKDTLVSLTPLFQHFPYFMSENFTILDCMLAPIFIRLKSMGIELPRQ
HCRPILLYCQRIFSRPAFVKSMTQQEKNRFNEILVNQ