Protein Info for MPMX26_00525 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 352 (332 residues), 94 bits, see alignment E=4.5e-31

Best Hits

KEGG orthology group: None (inferred from 70% identity to abc:ACICU_00568)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>MPMX26_00525 hypothetical protein (Acinetobacter radioresistens SK82)
MDNSQDISQNRPLLWLMAIACGLCAGVNYYCQPLVHSIQQYFAVTEAQAALTVTFAQVSY
ALGLLFIVPLGDILNKSRFIPLLMFFAAIGLLLCGFAINLPMLWVGTVIAGLFSVAAQVL
IPLATMAVQPEKTGEVVGFLMSGLLIGILLSTSLAGVLSNLFEWNIIYLASAVMMLCLAY
LLKSRLPYVMRFKMGYLQIFSSMASLIKEENRLVLRSLVGGCAFASVSTLFSTIAVLLSG
PAFQLPDFMIGLIPLMGIFGALSTQWIGKQADKGYTRILTWIGCGLLGISWIAFYFTQHS
LISYVTGFGIIHLGLAIVHSCNQNIVFRLRPDAKSRLNAIYMTMYFIGAAGGSALGIYAW
HHGGWLMTCLAGFSLALAATIFALIDQLIKHEPQQV