Protein Info for MPMX26_00481 in Acinetobacter radioresistens SK82

Annotation: tRNA threonylcarbamoyladenosine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 226 to 246 (21 residues), see Phobius details PF00899: ThiF" amino acids 17 to 250 (234 residues), 130.5 bits, see alignment E=2.6e-42

Best Hits

Swiss-Prot: 45% identical to TCDA_ECOLI: tRNA threonylcarbamoyladenosine dehydratase (tcdA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to abm:ABSDF2962)

MetaCyc: 45% identical to tRNA threonylcarbamoyladenosine dehydratase (Escherichia coli K-12 substr. MG1655)
RXN0-7115

Predicted SEED Role

"HesA/MoeB/ThiF family protein related to EC-YgdL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>MPMX26_00481 tRNA threonylcarbamoyladenosine dehydratase (Acinetobacter radioresistens SK82)
MTELLQNDEYERRFAAVAKIYGDEAFNYYEHSHVMVIGIGGVGSWAVEALARSGIGELTL
VDMDVVAASNINRQLPAMTATLGQEKIAVMAERCYSINPRIKVNLVDDYLFSDNVKEILA
MAPDLVLDCIDDVKAKLALMLHCRFNKIPLIVSGGAGGKLDPLKIRVADLSKTEQDPMLA
KLRTQLRSKGICKKPKEKFGITCIYSIDNPFSSSEVCTSAGLRCGGYGSAVVVTSSFAMV
AVAEVLRKLEAIKAKQ