Protein Info for MPMX26_00443 in Acinetobacter radioresistens SK82

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00512: HisKA
  • amino acids 179 to 245 (67 residues), 32.6 bits, E=7e-12
• PF02518: HATPase_c
  • amino acids 292 to 404 (113 residues), 87.7 bits, E=7.6e-29

Best Hits

KEGG orthology group: None (inferred from 60% identity to acd:AOLE_02695)

Predicted SEED Role

"putative sensory transduction histidine kinase"

Protein Sequence (425 amino acids)

>MPMX26_00443 Adaptive-response sensory-kinase SasA (Acinetobacter radioresistens SK82)
MTLQLLELDQADQLSACKLSLLLGIFEPHNQVESCLRFARRILRSKNAILTFKAEPYIWY
LSSKGMRLFHSHPDADLGPYFNSQPYIDQQHSDYHGFCQHIRHLGVEHQRMVAFDMLKTD
KESIGQILFFDDSSEPFENEDIEIVKDYCERLVRYLELKFEHAELKELYEQQSALNFSKT
KFFQIIAHDLRAPFHGLLGFSEVLSQERNTLDDSSIQNIADYLYDTAQSTYNLLESLLNW
AMAEGGRFVYHPINFNLKQVTKIVRDVLNTLAIKKNIQLIDEVPDDLKVYADINMLTSII
QNLVSNALKFTPMDGTGKVTIQAQPGPDGVEIYIRDTGLGMSEAQIANIFQPRITVSLKG
TAGEKGTGLGLTLCKRFVDLNKGEICVMSKEGEGTTFKVTLPEATDQHTVLPLDVAKSDS
TTNLV