Protein Info for MPMX26_00393 in Acinetobacter radioresistens SK82

Annotation: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 3 to 259 (257 residues), 263.2 bits, see alignment E=1.5e-82 PF01790: LGT" amino acids 9 to 254 (246 residues), 267.9 bits, see alignment E=3.5e-84

Best Hits

Swiss-Prot: 82% identical to LGT_ACIBC: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 82% identity to abc:ACICU_00471)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MPMX26_00393 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (Acinetobacter radioresistens SK82)
MLTYPSIDPVALALGPLKVHWYGLMYLLAFLFAWGLASYRVKQRVGWTTDMVSDLVFYGA
LGVVIGGRLGYVFFYGFDQFLANPLWLFEVWTGGMSFHGGFLGVMLAMLLWCRKYQKTWF
QTLDFIAPCVPTGLMFGRIGNFIGGELWGRPVINPDYPFGMVFPHVDNLVRHPSQLYQAL
GEGLILFIVLWWFSSKPRPRMAVSALFLIGYGIARFVVEFFREPDNGQLFIGWMSKGQFL
TLPMILIGLWMMWYAYHRKIYDWGPQKNT