Protein Info for MPMX26_00368 in Acinetobacter radioresistens SK82

Annotation: Glycerate 2-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02595: Gly_kinase
  • amino acids 5 to 376 (372 residues), 498.4 bits, E=6.1e-154
• TIGR00045: glycerate kinase
  • amino acids 5 to 378 (374 residues), 500.1 bits, E=1.9e-154

Best Hits

Swiss-Prot: 52% identical to GLXK_HAEIN: Glycerate kinase (glxK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 67% identity to aci:ACIAD2850)

MetaCyc: 47% identical to glycerate 2-kinase 1 (Escherichia coli K-12 substr. MG1655)
GKI-RXN [EC: 2.7.1.165]

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

• 2-O-α-mannosyl-D-glycerate degradation (1/2 steps found)
• D-glucarate degradation I (2/4 steps found)
• D-galactarate degradation I (2/4 steps found)
• glycolate and glyoxylate degradation I (2/4 steps found)
• superpathway of glycol metabolism and degradation (4/7 steps found)
• photorespiration II (6/10 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
• formaldehyde assimilation I (serine pathway) (7/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (5/31 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.165 or 2.7.1.31

Protein Sequence (384 amino acids)

>MPMX26_00368 Glycerate 2-kinase (Acinetobacter radioresistens SK82)
MAPTFVLAPDSFKESMTALQACHAMQNGLSKIFPEAVFIKVPMADGGEGTLDTLIAAAQG
QQVKCQVTGPLPAQKVESYFGLIDAGQTAVIEMAKANGIHLLTPAERNPLLTTTYGTGEM
IRLALDLGVSRIIIGLGGSVTNDAGAGMAQALGVHFYDNNGHEVSLGGRELDRVKTIDWS
RLDPRLKTTEIIIASDVNNPLTGAQGASYIFGPQKGATPDMVLQLDHNLSHFADIVEQQL
NLRKREVPGAGAAGGLGFGLLVFTGARIQSGVELVIQETQLEKYIARADYIFTGEGRLDE
QSCFGKTPVGVARLARQYGKPVIACAGSIGPQADTLYKEGFTAIFGILDQSSDIIAACQN
GAINLERTCENIGRILKLAEKQGR