Protein Info for MPMX26_00358 in Acinetobacter radioresistens SK82

Annotation: D-inositol-3-phosphate glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF13579: Glyco_trans_4_4" amino acids 13 to 161 (149 residues), 48.4 bits, see alignment E=4.2e-16 PF13439: Glyco_transf_4" amino acids 13 to 165 (153 residues), 98 bits, see alignment E=2e-31 PF13477: Glyco_trans_4_2" amino acids 19 to 132 (114 residues), 29.4 bits, see alignment E=2.6e-10 PF20706: GT4-conflict" amino acids 125 to 317 (193 residues), 43.2 bits, see alignment E=8e-15 PF00534: Glycos_transf_1" amino acids 190 to 339 (150 residues), 88.8 bits, see alignment E=9.4e-29 PF13692: Glyco_trans_1_4" amino acids 195 to 334 (140 residues), 71.4 bits, see alignment E=3.1e-23

Best Hits

KEGG orthology group: None (inferred from 84% identity to abc:ACICU_00440)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX26_00358 D-inositol-3-phosphate glycosyltransferase (Acinetobacter radioresistens SK82)
MKVMQLLPELNSGGVERGTLEIARALVSQGHQSLVVSNGGRLVAQLEAEGSTHLTLPVHK
KSLSSLWQIRPLRRLIMQYQPDIVHVRSRVPAWLTHFALRGIPASQRPHLISTVHGFYSV
NRYSEIMTQAEKVIAVSDSVVQYITEHYKNCPPQDIVRIYRGIDPKAFPHGYQPSAQWIH
QVFVDYPQLEHKFLLCLPGRITRLKGHEVLIEVMAALKPFYPQLHAVVVGGADPKKQAYL
EELANTIQNKGLGDDITFVGHRSDIREWLAFSDVVLSLSTQAETFGRTALEALSVGTPVI
GWNRGGVAEILAKLYPQGLIPSEDMNTLLGTIKQHIDQPQQVAPVTLFSLSDMCQQTLDL
YQQVINSKERQY