Protein Info for MPMX26_00333 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details PF00892: EamA" amino acids 21 to 148 (128 residues), 41.4 bits, see alignment E=8.9e-15 amino acids 159 to 295 (137 residues), 50.2 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: None (inferred from 51% identity to acd:AOLE_04255)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>MPMX26_00333 hypothetical protein (Acinetobacter radioresistens SK82)
MSSTASGTPSASLLFTSSVYALLVLIWATTPLAIVWSVEEVHPMWVLIIRYFGASILAFL
ILKLMRAPLPFDQMAMKSYLAGSLNLIGAQLFIYLAANYLTSGLMALIFGFSPLVAGLIG
HVILKTQKLVALQWLGMAIAVAGLSFVFADQAETQVNPIGVILMFISMVSYISSIFWVKE
INAPLAPMSQATGSLLVSALASLLLVPFIYEHIPTAIPGTKTIIGFLFTMVMSSIVAMLC
YFWLIKRLNASTVSLSNVITPVLALMLGATLNNEQIGSHTFAGVSIVMFGIVLYFWKDWH
SQYRVKKY