Protein Info for MPMX26_00332 in Acinetobacter radioresistens SK82

Annotation: 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 356 to 375 (20 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 5 to 300 (296 residues), 219.4 bits, see alignment E=2.5e-68 PF00070: Pyr_redox" amino acids 146 to 224 (79 residues), 48.7 bits, see alignment E=3.2e-16 PF14759: Reductase_C" amino acids 319 to 406 (88 residues), 50.2 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 46% identical to HCAD_PHOLL: 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component (hcaD) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K00529, ferredoxin--NAD+ reductase [EC: 1.18.1.3] (inferred from 46% identity to plu:plu2209)

MetaCyc: 45% identical to putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin reductase subunit (Escherichia coli K-12 substr. MG1655)
3-phenylpropanoate dioxygenase. [EC: 1.14.12.19]; 1.14.12.19 [EC: 1.14.12.19]

Predicted SEED Role

"Ferredoxin reductase" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19, 1.18.1.3

Use Curated BLAST to search for 1.14.12.19 or 1.18.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>MPMX26_00332 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component (Acinetobacter radioresistens SK82)
MSIETIVIIGAGQAGASAILELRANGYIGKIILVGDEVHLPYERPPLSKDVILKPEETKV
EILSVQKLAELGVEVIRGNAAVKIDADTHQLILKNGEVLGYDKLLLATGGAPRRLPDLDA
LGKHVYTLRNLEDSQALVPVLQSERRIILVGGGVIGLELASSARSKHCHVTVIEMGPMVM
GRCSPRLLSEFLLAQHRQAGIDIRLETRITGCSLQGEEVVIQLENGEELRADAVIYGVGI
IPNVRLAVEAGLDVDFAVKVNENCQTSNPDIYAAGDVATQLRADGQYSRVETWENANQQA
GIFARHVMGIEHPKANPAWFWTDQLGINFQFVGDMSAAEWHVRGTMDISQGPASSFILYG
VSNGIIVAGITVNAAKDMRHLKKMISKGIAFHADTHLDLAQELRKIA