Protein Info for MPMX26_00326 in Acinetobacter radioresistens SK82

Annotation: Hca operon transcriptional activator HcaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 226 to 247 (22 residues), see Phobius details PF00126: HTH_1" amino acids 3 to 61 (59 residues), 81.5 bits, see alignment E=3.5e-27 PF03466: LysR_substrate" amino acids 89 to 290 (202 residues), 112.2 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 40% identical to ALSR_BACSU: HTH-type transcriptional regulator AlsR (alsR) from Bacillus subtilis (strain 168)

KEGG orthology group: K05817, LysR family transcriptional regulator, hca operon transcriptional activator (inferred from 79% identity to abc:ACICU_00416)

Predicted SEED Role

"LysR family transcriptional regulator STM3121" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>MPMX26_00326 Hca operon transcriptional activator HcaR (Acinetobacter radioresistens SK82)
MELRHLRYFITVAEELNFSKAALKLYTAQPSLSQQIKDLEEDVGVKLLHRTKRKVELTEE
GAVFLEQARLTLAQADKAVAMARQVSKAKQQMLRIGFVPVAEMKVFPYVLPNLRVQNPDL
KIELLSLNNNEQMRLIKKGELDITFTRQNFQNDEIESQFVLREPLIFILPKDHPLTKYER
IPVKALDGIDFIIPAAEESLTLHNLILDFAKQNGIEFNIIQKADNILFNINSIGIGLGCT
ILPGYIAPLMMENTVIRPLSVELPFLDLYVSYRKDTALVTAHKFIELLTKVFYLDINRND
A