Protein Info for MPMX26_00306 in Acinetobacter radioresistens SK82

Annotation: Multidrug resistance protein NorM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 17 to 17 (1 residues), see Phobius details transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 48 to 75 (28 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 416 to 438 (23 residues), see Phobius details PF01554: MatE" amino acids 20 to 179 (160 residues), 100.9 bits, see alignment E=3.2e-33 amino acids 246 to 405 (160 residues), 107.5 bits, see alignment E=3e-35 TIGR00797: MATE efflux family protein" amino acids 20 to 420 (401 residues), 296.3 bits, see alignment E=1.7e-92

Best Hits

Swiss-Prot: 79% identical to NORM_ACIAD: Probable multidrug resistance protein NorM (norM) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 79% identity to aci:ACIAD0429)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>MPMX26_00306 Multidrug resistance protein NorM (Acinetobacter radioresistens SK82)
MSIATTTRFEIKKLFQLMLPILVTQFAQAGLGLIDTIMAGHLSPTDLAAIAVGVGLWIPI
MLLFSGIMIATTPLVAEANGARDFNNIPTIARQSLWMAFMLGILAMLVLQLMPFLLPLFG
VPENLQPKAGLFLHAIGFGMPAVTMYAALRGYSEALGYPRPVTAISLLALLVLVPLNMIF
MYGLGPIPALGSAGCGFATSILQWLMLIALAGYIYKGHAYRKTQVFSQWEKFNPVWAKRI
LKLGFPIGLAIFFEVSIFSTGAIILSPLGETVVAAHQIAISVTSQLFMIPMSLAIALTIR
VGMYYGEKNWHAMRKVQHLGLITATVFAVLTMLVMWIFRSEIVAVYTRDLAVTHMALYLI
LFAIAYQLMDAWQVSAAGCLRGMQDTKGPMWITLLAYWVIAFPVGIYLARFTRMGAAGVW
TGLIVGLSVACVLLLLRLYMNNKRLKLSTST