Protein Info for MPMX26_00254 in Acinetobacter radioresistens SK82

Annotation: Translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 908 PF08364: IF2_assoc" amino acids 63 to 99 (37 residues), 48.6 bits, see alignment (E = 2.4e-16) TIGR00487: translation initiation factor IF-2" amino acids 327 to 908 (582 residues), 822.6 bits, see alignment E=2.3e-251 PF04760: IF2_N" amino acids 334 to 381 (48 residues), 45.8 bits, see alignment 1.3e-15 TIGR00231: small GTP-binding protein domain" amino acids 410 to 567 (158 residues), 109.1 bits, see alignment E=2e-35 PF01926: MMR_HSR1" amino acids 413 to 518 (106 residues), 44 bits, see alignment E=6.7e-15 PF00009: GTP_EFTU" amino acids 413 to 567 (155 residues), 129.1 bits, see alignment E=4.8e-41 PF22042: EF-G_D2" amino acids 584 to 662 (79 residues), 92 bits, see alignment E=6e-30 PF11987: IF-2" amino acids 683 to 798 (116 residues), 133.6 bits, see alignment E=1e-42

Best Hits

Swiss-Prot: 84% identical to IF2_ACIB5: Translation initiation factor IF-2 (infB) from Acinetobacter baumannii (strain AB0057)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 84% identity to abc:ACICU_00350)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (908 amino acids)

>MPMX26_00254 Translation initiation factor IF-2 (Acinetobacter radioresistens SK82)
MTDKSIQELALSVGRPVEKLLEQVRDAGLPQRQAEDIITTEQQDVLVSHLKKVHGQADSG
VGKITLKRKTTSTAKVASTSGKAKTINVEVRKKHTFTKPNPEQIAAEARAKADAQEQARA
DMIARQKAEQAARQENDGQKLSGENKANATLEAMRAAAKQETAKSPQKAEVVVKKRSTNK
PIVKPVVKPTETAEQRKAREEQAAQLKAAEEAARRKAAEEAQQRTLEQMRQMASKYSNED
ATKTIRVVDDSPLAAGLVGQAYEDSFAKEDREIKRGTNTNNTRSPKKGGRRGQEEQSFNQ
NQHKRGLKTSQANKHGFEKPVKKQVYDVEIGSTIVVADLAQKMAVKVREVIKSLMKMGEL
VTQNQAIDQEIAALVVEEMGHNPVLVSDTQAEDNLLEAAEEARGAQTTRPPVVTIMGHVD
HGKTSLLDRIRRSKVAAGEAGGITQHIGAYHVKTDKGIITFLDTPGHAAFTAMRSRGAQA
TDIVVLVVAADDGVMPQTAEAIDHARAAGTPIIVAINKMDKESADPDRVLNELTTKEIVP
EQWGGDVPVAKVSAHSGEGIDELLDLIQIQAELMELKASEEGAAQGVVIEARVDKGRGAV
TSILVQNGTLNVGDLVLAGASYGRVRAMTDENGKRIKSAGPSIPVEILGLPEAPMAGDEV
LVVNDEKKAREVADARMDRERQKRLERQSAMRLENIMASMGKKDVPVVNVVLKTDVRGTL
EALHVALADLATDEVKVRIIGSGVGAITESDVTLAESSEAVLLGFNVRADNTARQKADID
GIDIRYYSVIYQLIDDVKDAMSGKLAPEHRETILGVAQVREVFRSSKFGAAAGCMVMEGT
IYRNKPIRVLRDDVVVFQGELESLRRYKDDVNEVRAGIECGLAVKGYNDIKELDKIEVYD
VQQIKRSL