Protein Info for MPMX26_00244 in Acinetobacter radioresistens SK82

Annotation: Type 4 prepilin-like proteins leader peptide-processing enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 222 to 250 (29 residues), see Phobius details amino acids 259 to 276 (18 residues), see Phobius details PF06750: A24_N_bact" amino acids 21 to 126 (106 residues), 108.5 bits, see alignment E=1.4e-35 PF01478: Peptidase_A24" amino acids 138 to 247 (110 residues), 89.4 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 54% identical to LEP4_AERHY: Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) from Aeromonas hydrophila

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 79% identity to acd:AOLE_17795)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MPMX26_00244 Type 4 prepilin-like proteins leader peptide-processing enzyme (Acinetobacter radioresistens SK82)
MQELITLLSNNPTALYIVVGLFSLCIGSFLNVVILRTPKMMEQEWRNECQLLLHPDQPLI
DETKLTLSYPASTCPNCHTPIRWYQNLPLVSWLLLRGKCGQCQNPISIRYPLVELLTALC
SLIVVAVYGPTLQMLFGLLLTWALITLTFIDFDTQLLPDRYTLPLAALGLALNSYALYTS
ASSAIWGYVIGFLCLWIVYYLFKVITGKEGMGYGDFKLLAALGAWMGPLMLPLIVLLSSL
VGAIIGIVLLKIRKENQPFAFGPYIAIAGWIAFLWGEQIMKIYLGG