Protein Info for MPMX26_00242 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details PF00892: EamA" amino acids 7 to 138 (132 residues), 57.6 bits, see alignment E=7.9e-20 amino acids 151 to 281 (131 residues), 47 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: None (inferred from 77% identity to abc:ACICU_00341)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MPMX26_00242 hypothetical protein (Acinetobacter radioresistens SK82)
MTPRVQGYLFVAITMCIWGGFTLFSRLNAQWHISPWDITALRFGLAFLILMPILLYKKDT
AFLWTRQSVLLALIGGLGYCLTVYTAFLYAPAAHAAIFLNGCIPLTTAVAAWILFKQPFD
QHTWLSLGIMLLALAVMSYLISRSSSHAFGIGDILLFTSAIWWGVFTVLLKQWKLSAWHS
MASVVIWSALIYVPIYLLFIPKHLSEPEPLHLVIQTLFHGVFVVIIATLTYVAAIERLGA
FKTGSIVTLAPFIAALLAIPLLGESLSLSVLAGLIGMSFGALQPWRWFRKDTLQAQLENQ
KKGSGSDSRIS