Protein Info for MPMX26_00236 in Acinetobacter radioresistens SK82

Annotation: p-hydroxybenzoic acid efflux pump subunit AaeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF00364: Biotin_lipoyl" amino acids 49 to 79 (31 residues), 22.8 bits, see alignment (E = 1.7e-08) PF25917: BSH_RND" amino acids 49 to 230 (182 residues), 43.7 bits, see alignment E=5.1e-15 PF25876: HH_MFP_RND" amino acids 109 to 176 (68 residues), 25.3 bits, see alignment E=3.8e-09 PF25963: Beta-barrel_AAEA" amino acids 234 to 330 (97 residues), 114.2 bits, see alignment E=6.1e-37

Best Hits

KEGG orthology group: None (inferred from 77% identity to aby:ABAYE3456)

Predicted SEED Role

"FIG00350677: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>MPMX26_00236 p-hydroxybenzoic acid efflux pump subunit AaeA (Acinetobacter radioresistens SK82)
MNSFDARKLLRPLSLLLVAAVALYAIIHLWNYYNAAPWTRDGRVKGDVMQVSSDVSGLVT
EVLVQDNQTVKKGQVLFKIDVARQALDVEQAKSDLAKAKAGLAEAEAALAQSHANSIKSQ
ANIRLAEKNAQRYASLMNGAISKQEQDQMFAVRDQARAEHEQMQAAIQQAQATIRQQKAL
IEAATSQVHLAELNLHRSAVIAPADGTLSNFDMRPGNYVKSGQAVAALVDRQQLYVVGYF
EETKLDRIHVGDKATVQLMGDSKKIYGHVQGIATGIEDRERGNSSNLLANVNPTFSWVRL
AQRVPVKIMIDKLPENRLTLVSGRTATVRIIEAKDHI