Protein Info for MPMX26_00218 in Acinetobacter radioresistens SK82

Annotation: Chaperone protein HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 PF13589: HATPase_c_3" amino acids 32 to 151 (120 residues), 39 bits, see alignment E=1.2e-13 PF02518: HATPase_c" amino acids 33 to 185 (153 residues), 29.2 bits, see alignment E=1.6e-10 PF00183: HSP90" amino acids 220 to 638 (419 residues), 428 bits, see alignment E=9.7e-132

Best Hits

Swiss-Prot: 88% identical to HTPG_ACIAD: Chaperone protein HtpG (htpG) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 90% identity to abn:AB57_0378)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (640 amino acids)

>MPMX26_00218 Chaperone protein HtpG (Acinetobacter radioresistens SK82)
MSEQSTSQNYSFQAEVAQLLHLVTHSLYSNPEIFLRELISNASDACDKLRFEGINHPEYY
ENDPDLHVRISLDKDNKTITISDNGIGLSQQEAIDNLGTIAKSGTKDFMSKLTGDQKSDA
QLIGQFGVGFYSGFIVADKITVESRRAGAEANEGVRWISGGTGEFEVQQIEKVSRGTDII
LHLREDALQYLESYKVKQIVNKYSDHISLPIQMQKEVWQEEEATEGEEAKGGKMVKTDEW
EVINSASALWTRNKNEITEEQYIEFYKNLTHDFEAPLAWAHNRVEGSTEYTQLLYVPSKA
PHDIFTREAKAGIKLYVKRVFIMDDADNLIPNYLRFVQGVVDSADLPLNVSRELLQESRD
VKTIREGNARRILTMLDALAKSEDEKDQEKFKQFYTEFGAVLKEGLGEDFSNRERILKLL
RYATSNNDEITTSLTDYKARMKDGQKAIYYVTADSLTAAKNSPQLELFKKKGIEVLLMSE
RVDEWAMNFVNEFDGMPMQNISKGAVDLGDLQDAEEKKALEQAQEQLKPVVEKLSGALKD
KTKEVRVTTRLVDSPACLVTAEGELSPQLIRMLKQAGQPIPESKPILEINPEHPLVQKLE
NTEQFDELANVIFDQAMIAEGGLPEDPAAYLKRINSLLLK