Protein Info for MPMX26_00199 in Acinetobacter radioresistens SK82

Annotation: Anthranilate synthase component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 TIGR00564: anthranilate synthase component I" amino acids 26 to 488 (463 residues), 526.1 bits, see alignment E=4.5e-162 PF04715: Anth_synt_I_N" amino acids 27 to 173 (147 residues), 121.5 bits, see alignment E=3.3e-39 PF00425: Chorismate_bind" amino acids 221 to 480 (260 residues), 295.3 bits, see alignment E=4.3e-92

Best Hits

Swiss-Prot: 86% identical to TRPE_ACICA: Anthranilate synthase component 1 (trpE) from Acinetobacter calcoaceticus

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 86% identity to aci:ACIAD0297)

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>MPMX26_00199 Anthranilate synthase component 1 (Acinetobacter radioresistens SK82)
MTTLNQFESLKHAGYNLIPVYRQRLADTETPLSVFARLKHHSQAYLFESVEGGENWARYS
MIGLGESVVFSCNEGELTVKATDGQLTTQLCDDPFQFIRDFQAQFKVPDAQLLPGLPGFT
GGLVGYFGYDAVRYIEPKLNNMPQADPVGLPDIWMMLSKTVIIFDNLKDTLFLIVHADIN
DPEAYQRAQLQLDHLEQILNTPISLQAYPHTPPHFESLTGKDRFLESIETVKEYIRAGDV
MQVVPGHRMVSEFDGEALQVYRALRHLNPSPYLFLVQGQTLTDGKPFHIVGSSPEILSRL
ENGIATVRPLAGTRPRGKTKEEDWALEQDLLSDEKEIAEHLMLIDLGRNDIGRVSQIGKV
QVTDRMVIERYSHVMHIVSNVQGEVSEGIDALDVFKATFPAGTLSGAPKIRAMQIIDEVE
PVKRGIFGGAVGYLGWHGEMDMSIAIRTCVIRENKVYVQAGAGLVADSNPESEWNETQIK
ARAVIKAVELSSNGLIL