Protein Info for MPMX26_00185 in Acinetobacter radioresistens SK82

Annotation: Argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 1 to 454 (454 residues), 648.8 bits, E=2.6e-199
• PF00206: Lyase_1
  • amino acids 4 to 298 (295 residues), 263.7 bits, E=2.7e-82
• PF14698: ASL_C2
  • amino acids 361 to 430 (70 residues), 97.1 bits, E=6.9e-32

Best Hits

Swiss-Prot: 92% identical to ARLY_ACIBY: Argininosuccinate lyase (argH) from Acinetobacter baumannii (strain AYE)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 92% identity to abc:ACICU_00281)

MetaCyc: 46% identical to argininosuccinate lyase (Homo sapiens)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• superpathway of arginine and polyamine biosynthesis (8/17 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (459 amino acids)

>MPMX26_00185 Argininosuccinate lyase (Acinetobacter radioresistens SK82)
MWGGRFSEATDAFVAEFTASVQFDQRFYKQDIAGSIAHATMLAKVGVLTEQERDDIIEGL
TAIKADIEAGNFEWRIDLEDVHMNIESRLTQRIGITGKKLHTGRSRNDQVATDIRLYVRD
EIDAILDLLEKLQKGILGLAAKNTQTIMPGFTHLQTAQPVTFGHHLLAWFEMLVRDSERL
IDCRKRVNRMPLGSAALAGTTYPIDRAYTAELLGFEAVAENSLDAVSDRDFAIEFNAAAS
LIMMHLSRMSEELILWTSAQFKFVNIPDRFCTGSSIMPQKKNPDVPELVRGKTGRVYGDL
MSLLTLMKGQPLAYNKDNQEDKEPLFDAIDTVRGSLMAFADMIPALVPNIDIMREAALRG
FSTATDLADYLVKNGVAFRDAHEIVGKAVALGVQEGKDLSELSLEQLQQFSDLIQTDVFE
KALTLEASVNARNHIGGTAPAQVEAAIDRAHARLEKLYA