Protein Info for MPMX26_00147 in Acinetobacter radioresistens SK82

Annotation: Competence protein ComM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR00368: Mg chelatase-like protein" amino acids 6 to 491 (486 residues), 619.6 bits, see alignment E=1.8e-190 PF13541: ChlI" amino acids 21 to 142 (122 residues), 149.1 bits, see alignment E=1.6e-47 PF01078: Mg_chelatase" amino acids 190 to 392 (203 residues), 318.3 bits, see alignment E=5.7e-99 PF00158: Sigma54_activat" amino acids 205 to 343 (139 residues), 21.6 bits, see alignment E=4.6e-08 PF07728: AAA_5" amino acids 214 to 346 (133 residues), 38.5 bits, see alignment E=3.5e-13 PF00493: MCM" amino acids 284 to 354 (71 residues), 27.2 bits, see alignment E=5.9e-10 PF13335: Mg_chelatase_C" amino acids 400 to 491 (92 residues), 95.8 bits, see alignment E=5.8e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 80% identity to abb:ABBFA_003315)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>MPMX26_00147 Competence protein ComM (Acinetobacter radioresistens SK82)
MSFAKIYTRGVLGLHAPSIEVEVHVSQGLPSLTIVGLPEAAVRESKDRVRSAIINSGFQF
PTKRLTINLAPADLPKDGSRLDLPIALGILVASGQLPEQSTEQIEFIGELALDGCLRPVS
GTLAIAMACQKVRHQLILAEANAMEAAQLPDFQVYGAQHLKQVCQHLLQQQPLLPVKRKL
PEAAQDYKLDLADIKGQLRPRRALEIAAAGGHSLLFKGPPGTGKTLLASRLPSILPPPNA
QENLEVASIYSIANVQHPFGQRPFRAPHHTASAIALVGGGSQPKPGEITLAHLGVLFLDE
LPEFDRKVLEVLRQPLESKEIVISRASRQMTFPANFQLVAAMNPCPCGYAFNQDNRCQCS
ADAIKRYQNRISGPLLDRIDLHIDVPPLQAHELQQTTPAENSDTVRKRVILAYEQQLQRQ
GCLNQLLSPKQLELHAQLDQSSLRIIEMAQQRLNLSARAYHRVLRVARTIADLALSKEIQ
TSHLSEALSYRSQS