Protein Info for MPMX26_00132 in Acinetobacter radioresistens SK82

Annotation: Putative multidrug resistance protein MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details amino acids 436 to 456 (21 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 17 to 422 (406 residues), 268.5 bits, see alignment E=5.5e-84 PF00083: Sugar_tr" amino acids 18 to 188 (171 residues), 32.7 bits, see alignment E=4e-12 PF07690: MFS_1" amino acids 22 to 282 (261 residues), 122.5 bits, see alignment E=2e-39 amino acids 276 to 463 (188 residues), 66.4 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 49% identical to MDTD_ECOL6: Putative multidrug resistance protein MdtD (mdtD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 72% identity to abc:ACICU_00208)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>MPMX26_00132 Putative multidrug resistance protein MdtD (Acinetobacter radioresistens SK82)
MAVTAEHQPVQAEYRLLVFLVSIGFFMQGLDTTIVNTAIASMAEQLNEDPLKMHSVVVAY
VLASAACIPLSGWLADRFGVRNTYLSAIVIFTLASLGCGLSENLNQLLFFRVIQGAGAAL
LLPIGRLSMLKIIPRTQFLSAMSLMSLAGLLGPLMGPTLGGWFVEAFSWHWIFLINVPIG
LLGCIMTFKAMPNVTEANVSSFDFSGFILLVLSMVGISLSIEVISNENYSNSLGWILFAV
GAIAMMAYATHAHWHQNALFRSSLFRKNPVFSIGILGNFFARLGGNSIPFVLPLMLQVAF
DISPLQTGLMMIPLVLGSLISKPLIRPLISRFGYRRFLIANTCLVGLTIASFALTTADTP
IWLRTLHFLVMGLLNSLQFVSMNTLTLKDLPQQDASKGNSFLSMIQMVSMSIGVALAGTL
INIFSNYYGPVDVSKAFHSALICLGLINILAMLIFWRVPDEKQIQPGS